Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Cys11&Cys27 bridge)
Size : 0.5
P1(RMB) : 766
MW : 3506
One letter sequence : TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (C11&C27 bridge)
Molecular Formula : C145H234N52O44S3
Description : Urodilatin (95-126) originally extracted from human urine that corresponds to the family of natriuretic-vasorelaxant peptides found earlier in heart atria. Infusion of this peptide is found to represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantion. The use of NATR-004 is protected by patents.
Literature Reference : P. Schultz-Knappe et al., Klin. Wochenschr., 66, 752 (1988)
Cas : [115966-23-9]
