Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge)
Size : 1
P1(RMB) : 766
MW : 3371.9
One letter sequence : CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2(Cys1&Cys7 bridge)
Molecular Formula : C145H240N42O46S2
Description : Single chain peptide with 32 amino acids that stimulates bone formation by inhibiting osteoblasts, induces bone reabsorption and increases cAMP levels in osteoclasts.
Literature Reference : T. Kurihara et al., Peptide Chemistry, 1985, 173 (1986)
Cas : [100016-62-4]
