His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Size : 0.5
P1(RMB) : 398
MW : 3325.9
One letter sequence : HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Molecular Formula : C147H238N44O42S1
Description : A 28 amino acid peptide synthesized in the central nervous system and gastrointestinal tract. It belongs to the secretin glucagon-CRF family and is widely distributed in the central and peripheral nervous systems. In acting as both a neurotransmitter and hormone that has powerful hypotensive and vasodilatory effects, this peptide plays a wide role in a range of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretin. When paired with the adrenegic drug phentolamine and injected, this peptide is expected to provide a new and effective solution for patients suffering from erectile dysfunction.
Literature Reference : J.J. Segura et al., Reg. Pep., 37, 145 (1992)
Cas :