Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys(Cys2 and Cys30/Cys4 and Cys19/Cys9 and Cys29 Bridge)
Size : 1
P1(RMB) : 4410
MW : 3486.09
One letter sequence : DCYCRIPACIAGERRYGTCIYQGRLWAFCC(Cys2 and Cys30/Cys4 and Cys19/Cys9 and Cys29 Bridge)
Molecular Formula : C151H222N44O40S6
Description : This peptide contain 6 conserved disulfide-linked cysteines. In vitro, it has a prominent antimicrobial activities against bacteria, fungi, and certain enveloped viruses. In addition, human and rabbit defensins exert potent cytotoxicity in vitro against various mammalian tumor cells.
Literature Reference : P.A.Raj et al., Biochem. J., 347, 633 (2000)
F.T.Lundy et al., Oral Oncol., 40, 139 (2004)
Z.Wu et al., J. Pept. Res., 64, 118 (2004)
Cas : 136661-76-2
