Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Trifluoroacetate salt
Size : 0.5
P1(RMB) : 1020
MW : 4348.91
One letter sequence : DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Formula : C194H300N54O58S
Description : This peptide is the English (H6R) mutation of beta-amyloid, which accelerates fibrillation without increasing protofibril formation. The English and Tottori mutations alter Abeta assembly at its earliest stages, monomer folding and oligomerization, and produce oligomers that are more toxic to cultured neuronal cells than are wild type oligomers. The exchange of His6 by Arg influences the structure of the Cu2+ complex formed by Abeta peptides.
Literature Reference : Y.Hori et al., J. Biol. Chem., 282, 4916 (2007)
K.Ono et al., J. Biol. Chem., 285, 23186 (2010)
B.Alies et al., Inorg. Chem., 50, 11192 (2011)
Cas : N/A