Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-Gly-Arg-Arg-Asp-Phe-Asp-Met-Leu-Arg-Cys-Met-Leu-Gly-Arg-Val-Tyr-Arg-Pro-Cys-Trp-Gln-Val
(Disulfide bond)
Trifluoroacetate salt
Size : 0.5
P1(RMB) : 1260
MW : 4186.84
One letter sequence : EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
Molecular Formula : C182H282N54O52S4
Description : Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat) has been shown to be more potent in stimulating feeding in the rat than MCH following intracerebroventricular administration although it did not exhibit better agonist activity in in vitro assays. Its enhanced activity in feeding behaviour compared to MCH might be due to its reduced susceptibility to proteolytic degradation by MCH-degrading enzymes such as endopeptidase 24.11 and aminopeptidase M.
Literature Reference : A.Viale et al., J. Biol. Chem., 274, 6536 (1999)L.Maulon-Feraille et al., J. Pharmacol. Exp. Ther., 302, 766 (2002)
Cas :