Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Trifluoroacetate salt
Size : 0.5
P1(RMB) : 634
MW : 4024.8
One letter sequence : FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Molecular Formula : C182H300N56O45S
Description : This peptide is the fragment 6-38 of PACAP, which is a much more potent and selective inhibitor of PACAP-27-stimulated pituitary adenylate cyclase than PACAP (6-27). Ki values for the inhibition of the enzyme were 7 nM and 150 nM respectively.
Literature Reference : P.Robberecht et al., Mol. Pharmacol., 42, 347 (1992)P.Robberecht et al., Eur. J. Biochem., 207, 239 (1992)F.Ohno et al., Regul. Peptides, 126, 115 (2005)P. Robberecht, P. Gourlet, P. De Neef, M-C. Woussen-Colle, M-C. Vandermeers-Piret,A. Vandermeers, and J. Christophe, Eur. J. Biochem., 207, 239 (1992). (Original)A. Vandermeers, S. Vandenborre, X. Hou, P. De Neef, P. Robberecht, M-C. Vandermeers-Piret,and J. Christophe, Eur. J. Biochem., 208, 815 (1992). (Pharmacol.)
Cas : 143748-18-9
